powered by:
Protein Alignment mib2 and sqst-4
DIOPT Version :9
Sequence 1: | NP_001260554.1 |
Gene: | mib2 / 35170 |
FlyBaseID: | FBgn0086442 |
Length: | 1049 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507173.1 |
Gene: | sqst-4 / 189561 |
WormBaseID: | WBGene00012516 |
Length: | 177 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 21/67 - (31%) |
Similarity: | 34/67 - (50%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 YQNQYDLIIVD--NAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIEHPF 126
|:..|.:|.:: ::.:...|..|.||.|... |.|..|||..|.:|.:|:.|.|.:.| .:|..
Worm 110 YRFPYLIINLEPCHSHIHPTHPIVRCDSCYTT-ITGHRFKCTICTDYDICSSCEARNAH-AQHTM 172
Fly 127 IR 128
:|
Worm 173 LR 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4582 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.