DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mib2 and sqst-4

DIOPT Version :9

Sequence 1:NP_001260554.1 Gene:mib2 / 35170 FlyBaseID:FBgn0086442 Length:1049 Species:Drosophila melanogaster
Sequence 2:NP_507173.1 Gene:sqst-4 / 189561 WormBaseID:WBGene00012516 Length:177 Species:Caenorhabditis elegans


Alignment Length:67 Identity:21/67 - (31%)
Similarity:34/67 - (50%) Gaps:4/67 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YQNQYDLIIVD--NAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIEHPF 126
            |:..|.:|.::  ::.:...|..|.||.|... |.|..|||..|.:|.:|:.|.|.:.| .:|..
 Worm   110 YRFPYLIINLEPCHSHIHPTHPIVRCDSCYTT-ITGHRFKCTICTDYDICSSCEARNAH-AQHTM 172

  Fly   127 IR 128
            :|
 Worm   173 LR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mib2NP_001260554.1 MIB_HERC2 8..73 CDD:284184 3/8 (38%)
ZZ_Mind_bomb 85..129 CDD:239079 17/44 (39%)
MIB_HERC2 156..220 CDD:284184
ANK 464..582 CDD:238125
ANK repeat 464..494 CDD:293786
Ank_2 468..560 CDD:289560
ANK repeat 496..527 CDD:293786
ANK repeat 529..560 CDD:293786
Ank_5 549..604 CDD:290568
ANK 557..685 CDD:238125
ANK repeat 596..628 CDD:293786
Ank_2 601..695 CDD:289560
ANK repeat 630..662 CDD:293786
ANK repeat 664..695 CDD:293786
zf-C3HC4_3 918..961 CDD:290631
zf-C3HC4_3 1002..1044 CDD:290631
sqst-4NP_507173.1 ZZ_NBR1_like 133..175 CDD:239080 17/44 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.