Sequence 1: | NP_001260554.1 | Gene: | mib2 / 35170 | FlyBaseID: | FBgn0086442 | Length: | 1049 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035148.1 | Gene: | Sqstm1 / 18412 | MGIID: | 107931 | Length: | 442 | Species: | Mus musculus |
Alignment Length: | 337 | Identity: | 75/337 - (22%) |
---|---|---|---|
Similarity: | 114/337 - (33%) | Gaps: | 129/337 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 HSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIEHPFIRYTTPNSLGVRLPMRKGAK 146
Fly 147 RIQLRGIFVGSKVVR--------GPDWE------WNEQD--GGEGRTGRVMEIRGWDNESCRSVA 195
Fly 196 NVAWVTG-----STNVYRLGHKGNVDLKY------ITAT-------------------CGGHYYK 230
Fly 231 ----DHMPVLGQTEEL---------QPVAPMVKPSFSVGDRVKVCL---EVD------------- 266
Fly 267 -----ALMKLQQGHGGW-------------NPRMVEHLSKL---------GTVHRI--TDKGDI- 301
Fly 302 ----RVQYENCP 309 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4582 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |