DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and BHLHE40

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_003661.1 Gene:BHLHE40 / 8553 HGNCID:1046 Length:412 Species:Homo sapiens


Alignment Length:456 Identity:106/456 - (23%)
Similarity:165/456 - (36%) Gaps:145/456 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 STQNVTSSQDISKRTNK---PLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEK 100
            |.:.:..|:| ||.|.|   .|:||:||.|||:.:|.||.|:.|..|.....:         |||
Human    39 SRRGIKRSED-SKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGH---------LEK 93

  Fly   101 ADILELTVRHFQRHRNLDDPTVNK------------------------YRAGYTDCAREVARYLA 141
            |.:||||::|.:...||.|....|                        :.:|:..|||||.:|||
Human    94 AVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLA 158

  Fly   142 TPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHG---KK 203
            ..|.         ......::|:.||.:.::|:                       |..|   |.
Human   159 KHEN---------TRDLKSSQLVTHLHRVVSEL-----------------------LQGGTSRKP 191

  Fly   204 SQPEEHSLDYSSQDSNPVDYSK--GLKMVAAEQRTLPVTPAPQ---DENNNRGLQAQAQTPIPIQ 263
            |.|....:|:..:.|:|...|:  |...|...|||...:...|   |.:.:.|...:::..   .
Human   192 SDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKG---D 253

  Fly   264 VQSQTQGQTSPH------VDAVAPSELSYEEDRNKVCANVLEQYKQQL---KAHVQQQPESANGV 319
            ::|:.....|.|      .:.:...:...||...|       :.:.||   :.|.......::..
Human   254 LRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTK-------KNRMQLSDDEGHFTSSDLISSPF 311

  Fly   320 LVLPPHYVQLAAALGLSAQP-------LVDPIATRTDFERLIELQRV-QPHLAGKLSPSFPGGLE 376
            |...||            ||       |:.|.||    ..|..|::. .|.....|.|    ||.
Human   312 LGPHPH------------QPPFCLPFYLIPPSAT----AYLPMLEKCWYPTSVPVLYP----GLN 356

  Fly   377 AAHVAAAAAAYANSMAVAASAGASVAAMATSGAGTPTVHQER---PASVAASVSSGVSMSELKSM 438
            |:  |||.:::.|...::|                |.:..:|   |.....||.|.|.:..||.:
Human   357 AS--AAALSSFMNPDKISA----------------PLLMPQRLPSPLPAHPSVDSSVLLQALKPI 403

  Fly   439 P 439
            |
Human   404 P 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 28/71 (39%)
Hairy_orange 125..172 CDD:284859 13/46 (28%)
BHLHE40NP_003661.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer 1..139 34/109 (31%)
bHLH-O_DEC1 40..129 CDD:381592 33/98 (34%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 14/75 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..303 26/153 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.