DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes7

DIOPT Version :10

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:68 Identity:17/68 - (25%)
Similarity:26/68 - (38%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IPTNELMTDGFRLLDVDNRVVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLNQTNFFIN 187
            :..|||...|.:||. |.     :.||...|.|:..::.......|...:...|..|.:.:...|
Mouse   688 LSNNELQDSGVKLLS-DG-----LKSQHCKLDTSGCMVTEEGCGFLSSALTSNPSHLRELDLSYN 746

  Fly   188 RPG 190
            .||
Mouse   747 HPG 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 bHLH_O_HES 58..116 CDD:381416
Hairy_orange 124..172 CDD:462193 12/47 (26%)
Hes7NP_149030.2 bHLH_SF 13..73 CDD:469605
PRK14954 <96..>189 CDD:184918
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.