DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes5

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:169 Identity:45/169 - (26%)
Similarity:61/169 - (36%) Gaps:67/169 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRN 116
            |..||::||.||.|||.|:..|| |:||....::..|       :|||||||||:.|.:.:..:.
  Rat    18 RLRKPVVEKMRRDRINSSIEQLK-LLLEQEFARHQPN-------SKLEKADILEMAVSYLKHSKG 74

  Fly   117 ------------------------LDDPTV-----------NKYRAGYTDCAREVARYL------ 140
                                    |..||.           ..|..||:.|.:|..::|      
  Rat    75 ELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAAS 139

  Fly   141 ----------------ATP--EPPPMGTMPTLAEPGSKA 161
                            |.|  |.|..|..|..|...:||
  Rat   140 DTQMKLLYHFQRPPAPAAPVKETPTPGAAPQPARSSTKA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 27/88 (31%)
Hairy_orange 125..172 CDD:284859 15/61 (25%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 27/63 (43%)
ORANGE 116..158 CDD:128787 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.