DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes5.1

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001037880.1 Gene:hes5.1 / 733463 XenbaseID:XB-GENE-481135 Length:154 Species:Xenopus tropicalis


Alignment Length:151 Identity:48/151 - (31%)
Similarity:73/151 - (48%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRN 116
            :..||::||.||.|||.|:..||||:        .|....|..:.|||||||||:.|.:.|:.::
 Frog    18 KLRKPIVEKMRRDRINNSIEQLKALL--------EKEFHKQEPNVKLEKADILEMAVSYLQQQKS 74

  Fly   117 LDDPTVNK----YRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDV- 176
             ..|.:.|    |:.|::.|.||..::|.        ..|...|  ::.:||:|| |...::.| 
 Frog    75 -QSPNLAKLEQDYKQGFSSCLREAVQFLC--------YYPESGE--TQMKLLKHL-QAPQKLSVA 127

  Fly   177 ------EICPHSTAAFAESPS 191
                  .:.....||.|.:||
 Frog   128 PLTYIPSVSDSKQAALASNPS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 27/64 (42%)
Hairy_orange 125..172 CDD:284859 13/46 (28%)
hes5.1NP_001037880.1 HLH 14..75 CDD:238036 27/65 (42%)
Hairy_orange 84..121 CDD:295407 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.