DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hey2

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_571697.2 Gene:hey2 / 58146 ZFINID:ZDB-GENE-000526-1 Length:324 Species:Danio rerio


Alignment Length:418 Identity:92/418 - (22%)
Similarity:150/418 - (35%) Gaps:162/418 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAK 87
            :|.:|||.|:      .....|:||.::::..:.::|||||.|||.||:.|:.|:..:.:.|.: 
Zfish    27 SGQSNGSFIR------CGSPTTTSQVMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS- 84

  Fly    88 NGEGQAKHTKLEKADILELTVRH------------FQRHRNLDDPTVNKYRAGYTDCAREVARYL 140
                    .|||||:||::||.|            |..|    ...::....|:.:|..||||||
Zfish    85 --------AKLEKAEILQMTVDHLKMLQATGGKGYFDAH----SLAMDFLSIGFRECLTEVARYL 137

  Fly   141 ATPE----PPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHG 201
            ::.|    ..|:           :.||:.||..|.::       ...||...             
Zfish   138 SSVEGLDSSDPL-----------RVRLVSHLSSCASQ-------REAAAMTT------------- 171

  Fly   202 KKSQPEEHSLDYSSQDSNPVDYSKGLKMVAA---EQRTLP--------VTPAPQDENNNRGLQAQ 255
                    |:.:..|..:|..::..|..:.|   :|..||        ::.|||     ||....
Zfish   172 --------SIAHHQQALHPHHWAAALHPIPAAFLQQSGLPSSESSSGRLSEAPQ-----RGAALF 223

  Fly   256 AQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVLEQYKQQLKAHVQQQPESANGVL 320
            :.:...::..|  .|..:|.|..::.|.||                   |.|.|.          
Zfish   224 SHSDSALRAPS--TGSVAPCVPPLSTSLLS-------------------LSATVH---------- 257

  Fly   321 VLPPHYVQLAAALGLSAQ--PLVDPIATRTDFERLIELQRVQPHLAGKLSPSFPGGLEAAHVAAA 383
                     |||...:||  ||                             |||.|......:..
Zfish   258 ---------AAAAAAAAQTFPL-----------------------------SFPAGFPLFSPSVT 284

  Fly   384 AAAYANSMAVAASAGASVAAMATSGAGT 411
            |::.|:| .|::|...|..:..:||:.:
Zfish   285 ASSVASS-TVSSSVSTSTTSQQSSGSSS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 25/80 (31%)
Hairy_orange 125..172 CDD:284859 15/50 (30%)
hey2NP_571697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 3/6 (50%)
HLH 49..105 CDD:238036 23/64 (36%)
Hairy_orange 125..162 CDD:284859 15/47 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..324 4/18 (22%)
YRPW motif 314..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.