DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes2.1

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:204 Identity:63/204 - (30%)
Similarity:89/204 - (43%) Gaps:57/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHR 115
            ::|.|||||||||||||.||..||.|||...       |:..::::|||||||||:|||..   |
Zfish    30 RKTLKPLMEKRRRARINDSLNHLKTLILPLV-------GKDASRYSKLEKADILEMTVRFL---R 84

  Fly   116 NLDDPT----VNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDV 176
            :|...:    .:.|:.||..|.:.::..|      |...:.|.|.    .|:...:.|.:|    
Zfish    85 DLPSSSAKGQTDSYKEGYKACLQRISTML------PQSNLETEAH----QRVSEFIQQSMA---- 135

  Fly   177 EICPHSTAAFAESPSSSSCFDLNHGKKSQPEEH--SLDYSSQDSNPVDYSKGLKMVAAEQRTLPV 239
                      :.|.|..:|...|....||..:.  ||..::...||:.             |:|.
Zfish   136 ----------SSSSSCQNCCAQNSKMISQMHQRLVSLRNNNSMENPIS-------------TVPA 177

  Fly   240 ----TPAPQ 244
                .||||
Zfish   178 PSQPQPAPQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 35/65 (54%)
Hairy_orange 125..172 CDD:284859 10/46 (22%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 35/65 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.