DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and HES6

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:237 Identity:65/237 - (27%)
Similarity:92/237 - (38%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQ--- 112
            ::..|||:||:||||||:||..|:.|:            .|.....|||.|::||||||..|   
Human    26 RKARKPLVEKKRRARINESLQELRLLL------------AGAEVQAKLENAEVLELTVRRVQGVL 78

  Fly   113 ----RHR-NLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIA 172
                |.| .|......::.|||..|..||..:::|.:    ....|:|     |.||.||     
Human    79 RGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQ----AIDATVA-----AELLNHL----- 129

  Fly   173 EIDVEICPHSTAAFAESPSSSSCF-DLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRT 236
               :|..|     ..|..|..... |...|....|............:|:....|    ..:...
Human   130 ---LESMP-----LREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPG----PGDDLC 182

  Fly   237 LPVTPAPQDENNNRGLQAQAQTP--IPIQVQSQTQGQTSPHV 276
            ..:..||:.|.:    ||.|:.|  :|..:.|.|..|.:..|
Human   183 SDLEEAPEAELS----QAPAEGPDLVPAALGSLTTAQIARSV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 29/73 (40%)
Hairy_orange 125..172 CDD:284859 14/46 (30%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 0/4 (0%)
HLH 23..75 CDD:238036 26/60 (43%)
Hairy_orange 96..134 CDD:311465 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205 12/65 (18%)
WRPW motif 221..224 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.