DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and HES2

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:177 Identity:63/177 - (35%)
Similarity:82/177 - (46%) Gaps:33/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHR 115
            :::.|||:||||||||||||:.||.|||.....:|       :..:||||||:||:|||..|...
Human    14 RKSLKPLLEKRRRARINQSLSQLKGLILPLLGREN-------SNCSKLEKADVLEMTVRFLQELP 71

  Fly   116 NLDDPTV-----NKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHL--DQCIAE 173
            ....||.     :.||.||:.|...:||.|....         :.||...||||.||  ....|.
Human    72 ASSWPTAAPLPCDSYREGYSACVARLARVLPACR---------VLEPAVSARLLEHLWRRAASAT 127

  Fly   174 IDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNP 220
            :|......|:...|.:|:.:|.          ||..|....|..|.|
Human   128 LDGGRAGDSSGPSAPAPAPASA----------PEPASAPVPSPPSPP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 33/65 (51%)
Hairy_orange 125..172 CDD:284859 16/48 (33%)
HES2NP_061962.2 HLH 12..70 CDD:238036 33/62 (53%)
ORANGE 84..127 CDD:128787 16/51 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 11/47 (23%)
WRPW motif 170..173
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.