DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes1

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001011194.1 Gene:hes1 / 496617 XenbaseID:XB-GENE-487995 Length:267 Species:Xenopus tropicalis


Alignment Length:318 Identity:96/318 - (30%)
Similarity:135/318 - (42%) Gaps:114/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KNKSAPGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKA 75
            ||.|:| :..|.|.            :|:|.:...:....::::||:||||||||||:||..||.
 Frog     8 KNSSSP-VAATPAS------------MSNTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKT 59

  Fly    76 LILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLD----------DPTV-NKYRAGY 129
            |||::.|       :..::|:|||||||||:||:|.   |||.          ||:| .|||||:
 Frog    60 LILDALK-------KDSSRHSKLEKADILEMTVKHL---RNLQRVQMTAALSTDPSVLGKYRAGF 114

  Fly   130 TDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEID-----------VEICPHST 183
            ::|..||.|:|:|.|.         .....:.|||.||..|:.:|:           ....||..
 Frog   115 SECMNEVTRFLSTCEG---------VNTDVRTRLLGHLANCMNQINAMNYPTQPQIPAAAAPHPA 170

  Fly   184 ----------AAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSK---GLKMVAAEQR 235
                      ||...||:..:|      |...|             ||:.:|   |.::|.|...
 Frog   171 YGQPLVQLQGAAPQSSPAPIAC------KMGGP-------------PVEAAKVYGGFQLVPAPDG 216

  Fly   236 ------TLPVTP-----APQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPS 282
                  |.|..|     .|...|:|.|      |.:|..|        ||   :|.||
 Frog   217 QFAFLITNPAFPHNGSVIPVYTNSNVG------TALPPSV--------SP---SVMPS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 34/68 (50%)
Hairy_orange 125..172 CDD:284859 17/46 (37%)
hes1NP_001011194.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 12/49 (24%)
bHLH-O_HES1_4 33..95 CDD:381465 36/71 (51%)
Hairy_orange 110..148 CDD:369405 17/46 (37%)
WRPW motif. /evidence=ECO:0000255 264..267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.