DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and cwo

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:437 Identity:96/437 - (21%)
Similarity:144/437 - (32%) Gaps:173/437 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QNVTSSQD-ISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADIL 104
            :|.||.|| :|.|    ::|||||.|:|..||.|..||    ..|..:.|.|     ::||.:|:
  Fly    56 RNKTSRQDPLSHR----IIEKRRRDRMNSCLADLSRLI----PPQYQRKGRG-----RIEKTEII 107

  Fly   105 ELTVRHFQRHRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQ 169
            |:.:||.:..::......:.||:||.||.:|.|::|....      |.....     |||..|.:
  Fly   108 EMAIRHLKHLQSECQQKESDYRSGYMDCMKEAAKFLYDVH------MQDFCH-----RLLGRLQE 161

  Fly   170 CIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQ 234
            .|.|:....|..||.:.....:.|:.....|.....|..|..|..:..::.|::|          
  Fly   162 HIDEMFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHS---------- 216

  Fly   235 RTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVLE 299
                     ||.|:.:                                :||:   ||        
  Fly   217 ---------QDHNDVK--------------------------------DLSF---RN-------- 229

  Fly   300 QYKQQLKAHVQQQPESANGVLVLPPHYVQLAAALGLSAQPLVDPIATRTDFERLIELQRVQPHLA 364
                    |:.|                                            |||.|...|
  Fly   230 --------HLNQ--------------------------------------------LQRSQQAAA 242

  Fly   365 GKLSPSFPGGLEAAHVAAAAAAYANSMAVAASAGASVAAMATSGAGTPTVHQERPASVAASVSSG 429
                        ||.|||||.|.||..:.|::||.......|:|.||                 |
  Fly   243 ------------AAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGT-----------------G 278

  Fly   430 VSMSELKSMPATQQSSPRSESGIGSNENEAPATSPRPQTSNAARQAL 476
            .:.....::|:....|..:.:..|.|.|.:.:.|     ||||...:
  Fly   279 GAPPAADNVPSNSTGSGSAAACAGGNSNSSGSNS-----SNAASSTI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 24/69 (35%)
Hairy_orange 125..172 CDD:284859 14/46 (30%)
cwoNP_524775.1 HLH 66..118 CDD:306515 23/64 (36%)
ORANGE 126..168 CDD:128787 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.