DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and cwo

DIOPT Version :10

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:175 Identity:35/175 - (20%)
Similarity:74/175 - (42%) Gaps:48/175 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FFNNYVN-RFLLHGQLIEMIWTI-LPAII--------LLFIALPSLRLLYLLDEIN--------- 91
            ::::|.: |..|||.:....:.: :.|:|        :.|..:| :.|.|:|..:|         
  Fly  1471 YYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMP-MGLKYVLKALNYFFTAVFTL 1534

  Fly    92 EPSVTLKSIGHQWYWSYEYSDFNNI------------EFDSYMIPTNELMTDGFRLLDVDNRV-- 142
            |.::.|.::|.:.::..:::..:..            ||::..:|.|..:....|:|.: .||  
  Fly  1535 EAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRI-ARVLK 1598

  Fly   143 VLPMNSQIR-ILVTAADVIHS------------WTVPALGVKVDG 174
            :|.|...|| :|.|..:.:..            :...||||::.|
  Fly  1599 LLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFG 1643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 bHLH_O_HES 58..116 CDD:381416 12/75 (16%)
Hairy_orange 124..172 CDD:462193 16/62 (26%)
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446
ORANGE 126..168 CDD:128787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.