DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:234 Identity:48/234 - (20%)
Similarity:89/234 - (38%) Gaps:79/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTV 108
            |:...|.::..||::|::||||:|:.|..||.|:.|.         .|.....:::||::||..|
  Fly     4 TTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAEL---------RGDDGILRMDKAEMLESAV 59

  Fly   109 ----------RHFQRHRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARL 163
                      :..|..::|   .::.::.||.:...||:|.:|             :.||....|
  Fly    60 IFMRQQKTPKKVAQEEQSL---PLDSFKNGYMNAVNEVSRVMA-------------STPGMSVDL 108

  Fly   164 ----LRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYS 224
                :.||.:....:.         .|.|:.|::...           ::|:|.||.|..|:   
  Fly   109 GKSVMTHLGRVYKNLQ---------QFHEAQSAADFI-----------QNSMDCSSMDKAPL--- 150

  Fly   225 KGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQ 263
                             :|.....:....:.|.:|.|:|
  Fly   151 -----------------SPASSGYHSDCDSPAPSPQPMQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 21/78 (27%)
Hairy_orange 125..172 CDD:284859 11/50 (22%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 19/65 (29%)
ORANGE 81..125 CDD:128787 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.