DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and E(spl)m7-HLH

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster


Alignment Length:197 Identity:57/197 - (28%)
Similarity:91/197 - (46%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQR-- 113
            ::..|||:|::||||||:.|..||.|:.|..    |:.|:     .|.|||||||:||:|.::  
  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECV----AQTGD-----AKFEKADILEVTVQHLRKLK 69

  Fly   114 --HRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDV 176
              .:::.......:||||...|.||:|.||        ::|.: :......|:.||...:.:::.
  Fly    70 ESKKHVPANPEQSFRAGYIRAANEVSRALA--------SLPRV-DVAFGTTLMTHLGMRLNQLEQ 125

  Fly   177 EICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPVTP 241
               |........:|.|..|     |..|....:|...|....:||  |.|   .|::..:|....
  Fly   126 ---PMEQPQAVNTPLSIVC-----GSSSSSSTYSSASSCSSISPV--SSG---YASDNESLLQIS 177

  Fly   242 AP 243
            :|
  Fly   178 SP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 28/69 (41%)
Hairy_orange 125..172 CDD:284859 14/46 (30%)
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/67 (42%)
ORANGE 81..125 CDD:128787 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.