DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:103/251 - (41%) Gaps:70/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKH-TKLEKADILELTVRHFQRH 114
            ::..|||:|::||||||:.|..||.|::|..:.      ||:  | |:|||||||||||.|.::.
  Fly    12 RKVMKPLLERKRRARINKCLDDLKDLMVECLQQ------EGE--HVTRLEKADILELTVDHMRKL 68

  Fly   115 RNL-------------DDPT------VNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSK 160
            :..             ..||      |..:|:||...|.::.:.|       :.|..| .|.|.|
  Fly    69 KQ
RGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVL-------LQTQQT-DEIGRK 125

  Fly   161 ARLLRHLDQCIAEIDVEIC-------PHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDS 218
              :::.|...:.|:..::.       .|......:| |....|.|..|........::.|||   
  Fly   126 --IMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQS-SGRLAFPLLGGYGPAAAAAAISYSS--- 184

  Fly   219 NPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSP 274
                      .:.::...:.||..  |.|      |.::|   ..|.||..|.:.|
  Fly   185 ----------FLTSKDELIDVTSV--DGN------ALSET---ASVSSQESGASEP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 31/66 (47%)
Hairy_orange 125..172 CDD:284859 11/46 (24%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 31/65 (48%)
ORANGE 96..136 CDD:128787 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438345
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.