DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:101/261 - (38%) Gaps:115/261 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKH-TKLEKADILELTVRHFQRH 114
            ::..||::|::||||||:.|..||.:::|.. ||     ||:  | |:|||||||||||.|.::.
  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECL-TQ-----EGE--HITRLEKADILELTVEHMKKL 70

  Fly   115 RNLD---------------DPTVN---KYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSK- 160
            |...               ||.::   .:||||...|.||::.||             |.||.. 
  Fly    71 RAQKQ
LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLA-------------AVPGVSV 122

  Fly   161 ---ARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVD 222
               .:|:.||.                                        |.|:|         
  Fly   123 DLGTQLMSHLG----------------------------------------HRLNY--------- 138

  Fly   223 YSKGLKMVAAEQRTLPV---TPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSEL 284
                |::|..   :||:   ..||.::      ||.. ||.|.:..|...|..||     ||||.
  Fly   139 ----LQVVVP---SLPIGVPLQAPVED------QAMV-TPPPSECDSLESGACSP-----APSEA 184

  Fly   285 S 285
            |
  Fly   185 S 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 32/66 (48%)
Hairy_orange 125..172 CDD:284859 15/50 (30%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 32/68 (47%)
ORANGE 97..141 CDD:128787 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.