DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and E(spl)mdelta-HLH

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster


Alignment Length:226 Identity:63/226 - (27%)
Similarity:94/226 - (41%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKA 101
            |...:.:|.:|...|.| |||:|::||||:|..|..||.||:::...|    ||   :.:|||||
  Fly     3 VQGQRFMTKTQHYRKVT-KPLLERKRRARMNLYLDELKDLIVDTMDAQ----GE---QVSKLEKA 59

  Fly   102 DILELTVRHF-----QRHRNLDDP-----TVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAE 156
            |||||||.:.     ||..|...|     .::|:|||||..|.||:...:|             .
  Fly    60 DILELTVNYLKAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFST-------------V 111

  Fly   157 PGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHG-KKSQPEEHSLDYSSQDSNP 220
            ||...:...||.:                           .|.|. |..:.||..:|.:.:..|.
  Fly   112 PGLDLKFGTHLMK---------------------------QLGHQLKDMKQEEEIIDMAEEPVNL 149

  Fly   221 VDYSKGLKMVAAEQRTLPVTPAPQDENNNRG 251
            .|..:              :.:|::|:.:.|
  Fly   150 ADQKR--------------SKSPREEDIHHG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 33/73 (45%)
Hairy_orange 125..172 CDD:284859 13/46 (28%)
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 34/75 (45%)
ORANGE 91..135 CDD:128787 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.