DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and her12

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:64/157 - (40%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHF-QRHR 115
            :..||::||.||.|||..:..||:|:        .|........||||||||||:||... |:.:
Zfish    23 KLRKPIVEKMRRDRINTCIDQLKSLL--------EKEFHSHDPSTKLEKADILEMTVSFLKQQIK 79

  Fly   116 NLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICP 180
            .........:..||:.|.||...:|:.               .|.|..|:||..         .|
Zfish    80 QQQQIPQRDFNEGYSHCWRESVHFLSL---------------HSNAGELQHLHS---------GP 120

  Fly   181 HSTAAFAESPSSSSCFDLNHGKKSQPE 207
            .:.:....:| :::|..||......|:
Zfish   121 KTNSTMGSTP-ATACSKLNTAALQHPD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 26/65 (40%)
Hairy_orange 125..172 CDD:284859 11/46 (24%)
her12NP_991182.1 HLH 19..74 CDD:238036 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.