DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and HELT

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001287710.1 Gene:HELT / 391723 HGNCID:33783 Length:242 Species:Homo sapiens


Alignment Length:311 Identity:67/311 - (21%)
Similarity:103/311 - (33%) Gaps:116/311 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQDISKRTNKP----LMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILEL 106
            |..:.:|...|    ::|||||.|||:.|..|.    ::.....||...|     |||||:|||:
Human     2 SDKLKERKRTPVSHKVIEKRRRDRINRCLNELG----KTVPMALAKQSSG-----KLEKAEILEM 57

  Fly   107 TVRHFQRHRNLDDPT-----------VNKYRAGYTDCAREVARYLAT------------------ 142
            ||::.:...:.|.|.           .|.:..||.:|.:.:..||.|                  
Human    58 TVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFL 122

  Fly   143 ---------PEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDL 198
                     |..||:|::|   ||               :...::.|........||..::.|..
Human   123 QSKARLGAEPAFPPLGSLP---EP---------------DFSYQLHPAGPEFAGHSPGEAAVFPQ 169

  Fly   199 NHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQ 263
            ..|                :.|..:..|    ||....||..|:               .|:|:.
Human   170 GSG----------------AGPFPWPPG----AARSPALPYLPS---------------APVPLA 199

  Fly   264 VQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVL-EQYKQQLKAHVQQQP 313
            ..:|   |.||.:..|...:..|        .|:: ..:...|..|..|.|
Human   200 SPAQ---QHSPFLTPVQGLDRHY--------LNLIGHAHPNALNLHTPQHP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 25/72 (35%)
Hairy_orange 125..172 CDD:284859 13/73 (18%)
HELTNP_001287710.1 bHLH-O_HELT 14..69 CDD:381414 23/63 (37%)
Hairy_orange 87..127 CDD:400076 6/39 (15%)
PRK14951 <133..>207 CDD:237865 22/129 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.