DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and HES3

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001019769.1 Gene:HES3 / 390992 HGNCID:26226 Length:186 Species:Homo sapiens


Alignment Length:188 Identity:54/188 - (28%)
Similarity:77/188 - (40%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLDD--- 119
            |||:||||||.||..||:|:        .|:...|.:..||||||||||:|::.   |:|.:   
Human     1 MEKKRRARINVSLEQLKSLL--------EKHYSHQIRKRKLEKADILELSVKYM---RSLQNSLQ 54

  Fly   120 -----PTVNKYRAGYTDCAREVARYL-------------ATPEPPPMGTMPTLAEPGSKARLLRH 166
                 |...:..:|:..|...|::.|             ..||.....||.: |..|.:|..|  
Human    55 GLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDS-AGLGQEAPAL-- 116

  Fly   167 LDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPE----EHSLDYSSQDSNP 220
                       ..|.:.|.:|.:|::.       |.:|.|.    ..||..||....|
Human   117 -----------FRPCTPAVWAPAPAAG-------GPRSPPPLLLLPESLPGSSASVPP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 28/58 (48%)
Hairy_orange 125..172 CDD:284859 12/59 (20%)
HES3NP_001019769.1 HLH 1..54 CDD:238036 29/63 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..186 9/36 (25%)
WRPW motif 175..178
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.