DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and h

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:511 Identity:129/511 - (25%)
Similarity:189/511 - (36%) Gaps:199/511 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFTAAGSTNGSG-------IKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKAL 76
            |.|||..||..|       :|...|.|           .:|:|||:||||||||||..|..||.|
  Fly     4 GVTAANMTNVLGTAVVPAQLKETPLKS-----------DRRSNKPIMEKRRRARINNCLNELKTL 57

  Fly    77 ILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQR--------HRNLDDPTVNKYRAGYTDCA 133
            ||::||       :..|:|:|||||||||.||:|.|.        .:..|...|||::||:.||.
  Fly    58 ILDATK-------KDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCV 115

  Fly   134 REVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDL 198
            .||:|:            |.: ||..:.|||:||..||..:..|:                    
  Fly   116 NEVSRF------------PGI-EPAQRRRLLQHLSNCINGVKTEL-------------------- 147

  Fly   199 NHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQ 263
             |.::.|.::.|:                     ..:.||..|:..::::.:|    |..|....
  Fly   148 -HQQQRQQQQQSI---------------------HAQMLPSPPSSPEQDSQQG----AAAPYLFG 186

  Fly   264 VQSQTQGQTSPHVDAVAPSELSYEEDRNKVCANVL-----EQYKQQLKAHVQQQPESANGVLVLP 323
            :|....|...|:...|.|::|.     |...|.||     :|.:|||..|.|||.:.|       
  Fly   187 IQQTASGYFLPNGMQVIPTKLP-----NGSIALVLPQSLPQQQQQQLLQHQQQQQQLA------- 239

  Fly   324 PHYVQLAAALGLSA--QPLVDPIATRTDFERLIELQRVQPHLAGKLSPSFPGGLEAAHVAAAAAA 386
               |..|||...:|  ||::..:..||             ...|..|.....|.|:|..::::.:
  Fly   240 ---VAAAAAAAAAAQQQPMLVSMPQRT-------------ASTGSASSHSSAGYESAPGSSSSCS 288

  Fly   387 YANSMAVAASAGASVAAMATSGAGTPTVHQERPASVAASVSSGVSMSELKSMPATQQSSPRSESG 451
            ||                    ..:|......|..:..||        ::.:|..||  |.|   
  Fly   289 YA--------------------PPSPANSSYEPMDIKPSV--------IQRVPMEQQ--PLS--- 320

  Fly   452 IGSNENEAPATSPRPQTSNAARQALRQRQEEEYHYMAQAAAAAAAAGQDESMWRPW 507
                                  ..::::.:||                 |..||||
  Fly   321 ----------------------LVIKKQIKEE-----------------EQPWRPW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 37/76 (49%)
Hairy_orange 125..172 CDD:284859 16/46 (35%)
hNP_001014577.1 HLH 29..88 CDD:238036 38/76 (50%)
ORANGE 106..141 CDD:128787 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445398
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105111at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.