DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes6

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:215 Identity:56/215 - (26%)
Similarity:93/215 - (43%) Gaps:66/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQ--- 112
            ::|.|||:||:||||||:||..|:.|:.:..            ...|:|.|::||:||:..:   
Zfish    20 RKTRKPLVEKKRRARINESLQELRLLLADPD------------AQVKMENAEVLEMTVKRVESIL 72

  Fly   113 RHRNLDDPTVN-----KYRAGYTDCAREVARYLAT-PEPPPMGTMPTLAEPGSKARLLRHLDQCI 171
            :::..:..:||     ::.|||..|..||..:::: |     |...|:|     |.||.||.:|:
Zfish    73 QNK
AKEADSVNREANERFAAGYIQCMHEVHTFVSSCP-----GIDATIA-----ADLLNHLLECM 127

  Fly   172 AEIDVE---------------------------ICPHST-------AAFAESPSSSSCFDLNHGK 202
            ...|.|                           :.|..|       :|.:.:||::|..|:....
Zfish   128 PLNDEERFQDILSDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTSSDDICSDL 192

  Fly   203 KSQPEEHS-LDYSSQDSNPV 221
            .....||| :...:.|..||
Zfish   193 DDTDTEHSRISVDAGDQAPV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 23/68 (34%)
Hairy_orange 125..172 CDD:284859 16/47 (34%)
hes6NP_919381.2 HLH 18..75 CDD:238036 23/66 (35%)
Hairy_orange 90..128 CDD:284859 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.