Sequence 1: | NP_523599.1 | Gene: | Sidpn / 35168 | FlyBaseID: | FBgn0032741 | Length: | 507 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_919381.2 | Gene: | hes6 / 373116 | ZFINID: | ZDB-GENE-030828-5 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 56/215 - (26%) |
---|---|---|---|
Similarity: | 93/215 - (43%) | Gaps: | 66/215 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQ--- 112
Fly 113 RHRNLDDPTVN-----KYRAGYTDCAREVARYLAT-PEPPPMGTMPTLAEPGSKARLLRHLDQCI 171
Fly 172 AEIDVE---------------------------ICPHST-------AAFAESPSSSSCFDLNHGK 202
Fly 203 KSQPEEHS-LDYSSQDSNPV 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sidpn | NP_523599.1 | HLH | 48..117 | CDD:238036 | 23/68 (34%) |
Hairy_orange | 125..172 | CDD:284859 | 16/47 (34%) | ||
hes6 | NP_919381.2 | HLH | 18..75 | CDD:238036 | 23/66 (35%) |
Hairy_orange | 90..128 | CDD:284859 | 16/47 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |