DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and heyl

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_859425.1 Gene:heyl / 335134 ZFINID:ZDB-GENE-030131-7074 Length:310 Species:Danio rerio


Alignment Length:339 Identity:85/339 - (25%)
Similarity:133/339 - (39%) Gaps:119/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRDKDYSKNKS--------------APGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTN 54
            ||..|||...|              .|..|..:.|||                   ||.::::..
Zfish     2 KRPHDYSSPDSDTDELIDVGQEDSYCPVTGSMSPGST-------------------SQILARKKR 47

  Fly    55 KPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQ------- 112
            :.::|||||.|||.||:.|:.|:..:.:.|.:         :|||||:||::||.|.:       
Zfish    48 RGIIEKRRRDRINHSLSELRRLVPSAFEKQGS---------SKLEKAEILQMTVDHLKLLHAMGG 103

  Fly   113 ------RHRNLDDPTVNKYRA-GYTDCAREVARYLATPE----PPPMGTMPTLAEPGSKARLLRH 166
                  |...:|      ||. |:.:|..||.|||::.|    ..|:|           |||:.|
Zfish   104 KGYFDARALAVD------YRTLGFRECVGEVVRYLSSLEGVESSDPIG-----------ARLVSH 151

  Fly   167 LDQCIAEID--------VEICPHSTAAF-----AESPSSSSCFDLNHGKKSQPEEHS--LDYSSQ 216
            |..|.:|:|        :...|...|:|     |..|:||:.|..|..:...|...:  |.|.  
Zfish   152 LSHCASELDPLLQSPAALPFPPWPWASFPQLQAASPPASSTPFPPNARRDLTPHGTATILGYP-- 214

  Fly   217 DSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTP-IPIQV----QSQTQGQTSPHV 276
                   |..|:|.:...:...:.||         |.:..|.| :|..:    |...:|:|.|..
Zfish   215 -------SPALRMGSLSTQGTILNPA---------LTSVRQLPSVPGHLHRLQQHSPEGRTVPSS 263

  Fly   277 DA----VAPSELSY 286
            .:    .:|.::|:
Zfish   264 SSSSSNSSPPQISF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 24/81 (30%)
Hairy_orange 125..172 CDD:284859 18/51 (35%)
heylNP_859425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 6/18 (33%)
HLH 44..101 CDD:238036 23/65 (35%)
ORANGE 115..159 CDD:128787 19/60 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..310 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.