DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Heyl

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:388 Identity:87/388 - (22%)
Similarity:135/388 - (34%) Gaps:131/388 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRH 110
            ||..:::..:.::|||||.|||.||:.|:.|:..:.:.|.:         :|||||::|::||.|
  Rat    39 SQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS---------SKLEKAEVLQMTVDH 94

  Fly   111 -----------FQRHRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLL 164
                       |...|.|   .|:....|:.:|..||.|||...|.|.....|.      :.|||
  Rat    95 LKMLHASGGAGFFDARAL---AVDFRSIGFRECLTEVVRYLGVLEGPSSHADPV------RIRLL 150

  Fly   165 RHLDQCIAEIDVEICPHSTAAFAESPSS--SSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGL 227
            .||:...||::.........||...|.|  .||                             .||
  Rat   151 SHLNSYAAEMEPSPTTTGALAFPVWPWSFLHSC-----------------------------PGL 186

  Fly   228 KMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNK 292
            ..::::...|...|.|.       |...:..|.||...........|  ..:.|::.:....|..
  Rat   187 PSLSSQLAILGRVPGPV-------LPNVSSPPYPISALRSAPVHRVP--GTIPPAQRNLLPSRGV 242

  Fly   293 VCANVLEQYKQQLKAHVQQQPESANGVLVLPPHYVQLAAALGLSAQPLVDPIATRTDFERLIELQ 357
            ..:.         :||..::|.:       ||     ..|||:.|...:.||...:         
  Rat   243 TSSQ---------RAHPPERPAA-------PP-----PTALGVRAARSIVPILPCS--------- 277

  Fly   358 RVQPHLAGKLSPSFPGGLEAAHVAAAAAAYANSMAVAASAGASVAAMATSGAGTPTVHQERPA 420
                      ||:.||..::..                ||..|:::.:..|   ||   .|||
  Rat   278 ----------SPAAPGAGKSDD----------------SASGSISSPSPLG---PT---GRPA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 24/79 (30%)
Hairy_orange 125..172 CDD:284859 15/46 (33%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 25/78 (32%)
ORANGE 115..162 CDD:128787 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.