DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and her3

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:286 Identity:78/286 - (27%)
Similarity:110/286 - (38%) Gaps:96/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNA 86
            ||.|.:.:..|       .|||       |:.:||||||:||||||:.|..||:| |||..:.|.
Zfish     2 AAASNSAATAK-------PQNV-------KKVSKPLMEKKRRARINKCLNQLKSL-LESACSNNI 51

  Fly    87 KNGEGQAKHTKLEKADILELTVRHFQRHRNLDDPTVNK------YRAGYTDCAREVARYLATPEP 145
            :.       .||||||||||||:|. ||.......::|      |.|||..|...|:.||...: 
Zfish    52 RK-------RKLEKADILELTVKHL-RHLQNTKRGLSKACDSAEYHAGYRSCLNTVSHYLRASD- 107

  Fly   146 PPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHS 210
                     .:..|::.:|.:|..                           .|||.:..      
Zfish   108 ---------TDRDSRSIMLTNLTS---------------------------GLNHNRVP------ 130

  Fly   211 LDYSSQDSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPH 275
             |:|:.:|:|           |...|||.|           |:...:.||...|...:..||:..
Zfish   131 -DFSTVESDP-----------ALIFTLPST-----------LRRPHKVPIRTDVSYSSFQQTAER 172

  Fly   276 VDAVAPSELSY-EEDRNKVCANVLEQ 300
            ...:.|..... :.||..:.|.:..|
Zfish   173 KVCLMPKRTEIGDSDRMSLDAALRSQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 36/68 (53%)
Hairy_orange 125..172 CDD:284859 11/46 (24%)
her3NP_571155.1 HLH 17..77 CDD:238036 36/68 (53%)
ORANGE 88..129 CDD:128787 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.