DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and her6

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:312 Identity:93/312 - (29%)
Similarity:136/312 - (43%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KNKSAPGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKA 75
            ||.|:| :..|.|.            :::|.:...:....::::||:||||||||||:||..||.
Zfish     8 KNSSSP-VAATPAS------------MNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKT 59

  Fly    76 LILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLD----------DPTV-NKYRAGY 129
            |||::.|       :..::|:|||||||||:||:|.   ||:.          |||| .|||||:
Zfish    60 LILDALK-------KDSSRHSKLEKADILEMTVKHL---RNMQRAQMTAALNTDPTVLGKYRAGF 114

  Fly   130 TDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICP--HSTAAFAESPSS 192
            ::|..||.|:|:|.|    |....:     :.|||.||..|:.:|:....|  |...|....||.
Zfish   115 SECMNEVTRFLSTCE----GVNTEV-----RTRLLGHLASCMTQINAMNYPTQHQIPAGPPHPSF 170

  Fly   193 SSCFDLNHGKKSQPEEHSLDYSSQDSNPV-----------------DYSK---GLKMVAAEQRTL 237
                       |||.. .:..::|.:|.|                 |.:|   |.::|.|.....
Zfish   171 -----------SQPMV-QIPSATQQANVVPLSGVPCKSGSSSNLTSDATKVYGGFQLVPATDGQF 223

  Fly   238 -------------PVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHV 276
                         ||.|...:.:|         ||:|:.|.......||..|
Zfish   224 AFLIPNAAFAPNGPVIPVYANNSN---------TPVPVAVSPGAPSVTSDSV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 34/68 (50%)
Hairy_orange 125..172 CDD:284859 18/46 (39%)
her6NP_571154.2 HLH 32..95 CDD:238036 35/72 (49%)
Hairy_orange 110..148 CDD:284859 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.