DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes1

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:309 Identity:92/309 - (29%)
Similarity:133/309 - (43%) Gaps:88/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KNKSAPGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILKA 75
            ||.|:| :..|.|.            |::|.:...:....::::||:||||||||||:||:.||.
  Rat     8 KNSSSP-VAATPAS------------VNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKT 59

  Fly    76 LILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLD----------DPTV-NKYRAGY 129
            |||::.|       :..::|:|||||||||:||:|.   |||.          ||:| .|||||:
  Rat    60 LILDALK-------KDSSRHSKLEKADILEMTVKHL---RNLQRAQMTAALSTDPSVLGKYRAGF 114

  Fly   130 TDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHST----------- 183
            ::|..||.|:|:|.|    |....:     :.|||.||..|:.:|:....|...           
  Rat   115 SECMNEVTRFLSTCE----GVNTEV-----RTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPP 170

  Fly   184 ---------AAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGLKMVAAEQRTLPV 239
                     |.||..|   ....:..|....|........||.........|.::|         
  Rat   171 PSGPGGPQHAPFAPPP---PLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVV--------- 223

  Fly   240 TPAPQDE------NNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPS 282
             |||..:      |   |..|.:...||:..   :...||...:||:||
  Rat   224 -PAPDGQFAFLIPN---GAFAHSGPVIPVYT---SNSGTSVGPNAVSPS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 34/68 (50%)
Hairy_orange 125..172 CDD:284859 18/46 (39%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 11/48 (23%)
bHLH-O_HES1_4 33..95 CDD:381465 36/71 (51%)
Hairy_orange 110..148 CDD:400076 18/46 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 6/50 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 6/11 (55%)
WRPW motif 276..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.