DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes7

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:329 Identity:77/329 - (23%)
Similarity:111/329 - (33%) Gaps:128/329 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLDD 119
            |||:|||||.|||:||..|:.|:||.|:.||.:|       .|||||:|||..|.:.:....::.
  Rat    46 KPLVEKRRRDRINRSLEELRLLLLERTRDQNLRN-------PKLEKAEILEFAVGYLRERSRVEP 103

  Fly   120 P-------------------------------------------TVNKYRAGYT----------- 130
            |                                           .||..||..:           
  Rat   104 PGTARGVGQRREAGGWGARNARAGEGAGSEVDRGVGERPAVLPDEVNNTRACLSLCLPRCPPLHV 168

  Fly   131 -------DCAREVARYL-ATPEPPPMGTMP-----------TLAEPGSKARLLRH-----LDQCI 171
                   .|||..:..| ..|...|:|.:|           ....||..|..|..     ..:|:
  Rat   169 HPASCLCLCARLTSVSLRPAPSLNPVGPLPRPPVLPPAAPGVPRSPGQDAEALASCYLSGFRECL 233

  Fly   172 AEIDVEICPHSTAAFAE--SPSS-SSCFDLNHG----KKSQPEEHSLDYSSQDSN------PVDY 223
            ..:         ||||.  ||:: |..|...:|    |..:||       :.|..      |:|.
  Rat   234 LRL---------AAFAHDASPAARSQLFSALNGYRRPKPPRPE-------AADPGLPAPRPPLDP 282

  Fly   224 SKGLKMVAAEQRTLPV---TPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELS 285
            :..:...|..||. ||   .|:|:          .|.:|.....::...|..:|....:.|....
  Rat   283 ASPILGPALHQRP-PVHQGPPSPR----------LAWSPSHCSPRAGDSGAPAPLTGLLPPPPPP 336

  Fly   286 YEED 289
            |.:|
  Rat   337 YRQD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 30/61 (49%)
Hairy_orange 125..172 CDD:284859 15/81 (19%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.