DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and HEYL

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:270 Identity:72/270 - (26%)
Similarity:117/270 - (43%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TSSQDISKRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTV 108
            :|||..:::.::.::|||||.|||.||:.|:.|:..:.:.|.:         :|||||::|::||
Human    37 SSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS---------SKLEKAEVLQMTV 92

  Fly   109 RH-----------FQRHRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKAR 162
            .|           |...|.|   .|:....|:.:|..||.|||...|.|.....|.      :.|
Human    93 DHLKMLHATGGTGFFDARAL---AVDFRSIGFRECLTEVIRYLGVLEGPSSRADPV------RIR 148

  Fly   163 LLRHLDQCIAEIDVEICPHSTAAFAESPSS--SSCFDL----NH----GKKSQPEEHSLDYSSQD 217
            ||.||:...||::....|....||...|.|  .||..|    |.    |:...|   .|...|..
Human   149 LLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSP---VLPGVSSP 210

  Fly   218 SNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQA--------QAQTPIPIQVQSQT--QGQT 272
            :.|:   ..|:.....:.|..:.||.::...:||..:        :..||:|:...|:.  ....
Human   211 AYPI---PALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPVPVAPSSRAARSSHI 272

  Fly   273 SPHVDAVAPS 282
            :|.:.:.:|:
Human   273 APLLQSSSPT 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 24/79 (30%)
Hairy_orange 125..172 CDD:284859 15/46 (33%)
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 7/19 (37%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 23/77 (30%)
HLH 42..100 CDD:238036 22/66 (33%)
ORANGE 115..162 CDD:128787 17/52 (33%)
Atrophin-1 <136..311 CDD:331285 36/159 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.