DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Helt

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_006509452.1 Gene:Helt / 234219 MGIID:3040955 Length:241 Species:Mus musculus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:62/131 - (47%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRT--NKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQR 113
            |||  :..::|||||.|||:.|..|.    ::.....||...|     |||||:|||:||::.:.
Mouse     9 KRTPVSHKVIEKRRRDRINRCLNELG----KTVPMALAKQSSG-----KLEKAEILEMTVQYLRA 64

  Fly   114 HRNLDDPT-----------VNKYRAGYTDCAREVARYLATPEPPPMGTMPT-----LAEPGSKAR 162
            ..:.|.|.           .|.:..||.:|.:.:..||.|.|  .|.|..|     ||...||||
Mouse    65 LHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVE--RMETKDTKYARILAFLQSKAR 127

  Fly   163 L 163
            |
Mouse   128 L 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 26/67 (39%)
Hairy_orange 125..172 CDD:284859 17/44 (39%)
HeltXP_006509452.1 bHLH-O_HELT 14..69 CDD:381414 23/63 (37%)
Hairy_orange 87..127 CDD:369405 14/41 (34%)
PLN02983 <147..>213 CDD:215533
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.