DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and lin-22

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:261 Identity:67/261 - (25%)
Similarity:100/261 - (38%) Gaps:95/261 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LVSSTQNVTSSQDIS---KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTK 97
            |.|.|: :.|...||   |..|||||||:||||||:||:.||.::::    ...||   ..:|:|
 Worm     5 LCSDTE-IESDGGISRCKKIKNKPLMEKKRRARINKSLSQLKQILIQ----DEHKN---SIQHSK 61

  Fly    98 LEKADILELTVRHFQRHRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKAR 162
            .|||||||:.|.:.|:.|:..            .|:       .:|....:.|.||..|.     
 Worm    62 WEKADILEMAVEYLQQLRSAQ------------PCS-------LSPSTSSISTPPTPKEE----- 102

  Fly   163 LLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDSNPVDYSKGL 227
                    |..|.|.:.|  .|:|.                               ||:     :
 Worm   103 --------IRNIKVPLNP--IASFL-------------------------------NPM-----M 121

  Fly   228 KMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSPHVDAVAPSELSYEEDRNK 292
            :...|.|:...::...|..||..|:..:|...:..|         ||.:     :|....|||::
 Worm   122 QQYVAYQQLAQLSMYTQLFNNPAGVPLRADAGVTAQ---------SPEL-----AEKLKIEDRSR 172

  Fly   293 V 293
            |
 Worm   173 V 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 34/71 (48%)
Hairy_orange 125..172 CDD:284859 6/46 (13%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.