DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes3

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_011248491.1 Gene:Hes3 / 15207 MGIID:104877 Length:291 Species:Mus musculus


Alignment Length:198 Identity:53/198 - (26%)
Similarity:84/198 - (42%) Gaps:47/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SKNKSAPGIGFTAAGSTNGSGIKSIGLVSSTQNVTSSQDISKRTNKPLMEKRRRARINQSLAILK 74
            |.::....:...||...:|. :|.:|:                 :||||||:||||||.||..|:
Mouse    87 SPHRGTASVAQPAASERSGV-LKGMGI-----------------SKPLMEKKRRARINVSLEQLR 133

  Fly    75 ALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQRHRNLDD--------PTVNKYRAGYTD 131
            :|:        .::...|.:..||||||||||:|::.   |:|.:        |:...|.:|:..
Mouse   134 SLL--------ERHYSHQIRKRKLEKADILELSVKYM---RSLQNSLQGLWPVPSGVDYPSGFQG 187

  Fly   132 CAREVARYLATPEPPPMGTMPTLAE-------PGSKARLLRHLDQCIAEIDVEICPHSTAAFAES 189
            ..|.|::.|...|.......|.|.:       ..:..:....|:.|:..|   ..|...|..:.|
Mouse   188 GLRGVSQRLRPGEGDSGLRCPLLLQRREGSTTDSANPQATSVLNPCLPAI---WAPSRAAGGSHS 249

  Fly   190 PSS 192
            |.|
Mouse   250 PQS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 29/68 (43%)
Hairy_orange 125..172 CDD:284859 10/53 (19%)
Hes3XP_011248491.1 bHLH-O_HES3 117..171 CDD:381503 27/64 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.