DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and Hes2

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:148 Identity:56/148 - (37%)
Similarity:73/148 - (49%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQR-- 113
            ::..|||:|||||||||:||:.||.|:|...       |...::.:|||||||||:|||..|.  
Mouse    14 RKNLKPLLEKRRRARINESLSQLKGLVLPLL-------GAETSRSSKLEKADILEMTVRFLQEQP 71

  Fly   114 ---HRNLDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPGSKARLLRHLDQCIAEID 175
               :.:.....:|.|..||..|...:||.|     |....:    ||...||||.||.|.....|
Mouse    72 ATLYSSAAPGPLNSYLEGYRACLARLARVL-----PACSVL----EPAVSARLLEHLRQRTVSDD 127

  Fly   176 VEICPHSTAAFAESPSSS 193
               .|..|...|.:|:.|
Mouse   128 ---SPSLTLPPAPAPAPS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 32/70 (46%)
Hairy_orange 125..172 CDD:284859 17/46 (37%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 32/65 (49%)
ORANGE 85..123 CDD:128787 17/46 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 6/22 (27%)
WRPW motif 154..157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.