DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes6.1

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_017949954.1 Gene:hes6.1 / 100126814 XenbaseID:XB-GENE-1018104 Length:195 Species:Xenopus tropicalis


Alignment Length:187 Identity:59/187 - (31%)
Similarity:91/187 - (48%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KPLMEKRRRARINQSLAILKALILESTKTQNAKNGEGQAKHTKLEKADILELTVRHFQR-HRN-- 116
            |||:|||||||||:||..|:. ||..|:.|           :|:|.|::|||||:..:| .||  
 Frog    18 KPLVEKRRRARINESLQDLRG-ILSDTEFQ-----------SKMENAEVLELTVKRVERILRNRT 70

  Fly   117 -----LDDPTVNKYRAGYTDCAREVARYLAT-PEPPPMGTMPTLAEPGSKARLLRHL-------D 168
                 |......::.|||..|..||..:::: |     |...:||     |.||.||       :
 Frog    71 AEADRLQREASERFAAGYIQCMHEVHTFVSSCP-----GIDASLA-----AELLNHLLESMPLSE 125

  Fly   169 QCIAEIDVEICPHSTAA-------FAESPSSSSCFDLNHGKKSQPEEHSLDYSSQDS 218
            ..:.::.:::...||::       ...|.|..||.|:   ::|:.|:..:. |.|||
 Frog   126 GSLQDLVMDVLLDSTSSEEGCGLGVLGSSSEDSCSDM---EESEGEKAGMG-SVQDS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 30/69 (43%)
Hairy_orange 125..172 CDD:284859 15/54 (28%)
hes6.1XP_017949954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.