DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sidpn and hes2

DIOPT Version :9

Sequence 1:NP_523599.1 Gene:Sidpn / 35168 FlyBaseID:FBgn0032741 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:271 Identity:72/271 - (26%)
Similarity:104/271 - (38%) Gaps:108/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SIGLVSSTQNV-----TSSQDIS--KRTNKPLMEKRRRARINQSLAILKALILESTKTQNAKNGE 90
            ::.|..|..|.     ..:|:.|  ::|.|||||||||||||:||..||.|||...       |:
 Frog     4 NVALADSMHNYQPKTGKRNQEASELRKTLKPLMEKRRRARINESLNQLKTLILPLI-------GK 61

  Fly    91 GQAKHTKLEKADILELTVRHFQRHRNLDDPTV------NKYRAGYTDCAREVA-----RYLATPE 144
            ..::::|||||||||:|||..:     |.|.|      ::|:.||..|...::     .::.|.|
 Frog    62 DNSRYSKLEKADILEMTVRFLR-----DIPPVPAQNPADRYKEGYRACVERLSAILNKSHVLTGE 121

  Fly   145 PPPMGTMPTLAEPGSKARLLRHLDQCIAEIDVEICPHSTAAFAESPSSSSCFDLNHGKKSQPEEH 209
                          :..|||.||.:     ..|:|               |.|.:|    .|:.|
 Frog   122 --------------ASNRLLNHLQR-----SPELC---------------CSDCHH----PPKSH 148

  Fly   210 SLDYSSQDSNPVDYSKGLKMVAAEQRTLPVTPAPQDENNNRGLQAQAQTPIPIQVQSQTQGQTSP 274
            |                      .:..|.|:|...                  |::|....|.|.
 Frog   149 S----------------------PRIVLHVSPRTS------------------QLESPLLNQPSS 173

  Fly   275 HVDAVAPSELS 285
            |..|..|.:|:
 Frog   174 HRPAPCPPQLN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidpnNP_523599.1 HLH 48..117 CDD:238036 35/70 (50%)
Hairy_orange 125..172 CDD:284859 11/51 (22%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 37/75 (49%)
Hairy_orange 97..133 CDD:369405 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.