DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and robls54B

DIOPT Version :9

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001097356.1 Gene:robls54B / 5740248 FlyBaseID:FBgn0263233 Length:112 Species:Drosophila melanogaster


Alignment Length:95 Identity:24/95 - (25%)
Similarity:47/95 - (49%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVA-----RIYADRMRPLVILARSMVQDLENG 65
            |:..||.:.....|...::::.:|.||.:.:....|     ...|.|.|    |.|.| ..::..
  Fly    16 VEKAFDLVKSKKHVRDVVILNESGHPVMSTMDREDAVQFSGPFQAIRGR----LERGM-SKIDPT 75

  Fly    66 DELSYVRLRTRRQETMVATENEHTIILIQD 95
            |||..:|:|||..|.::..:::.|::::|:
  Fly    76 DELLMLRIRTRTNEVLLVPDSKITLLVVQN 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 22/92 (24%)
robls54BNP_001097356.1 Robl_LC7 16..103 CDD:214939 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.