DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and CG10834

DIOPT Version :10

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_610131.1 Gene:CG10834 / 35438 FlyBaseID:FBgn0032972 Length:97 Species:Drosophila melanogaster


Alignment Length:93 Identity:26/93 - (27%)
Similarity:48/93 - (51%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNTVQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDE 67
            |..::....|....|.|:|.|::|...:|::|.:...:...||..:..|...|..|:.:|:..:|
  Fly     2 SAEIEDLLKRYQNYPNVSGIIILDPFAIPIKTTMEYTLTVHYAALISTLTYKAAKMITNLDASNE 66

  Fly    68 LSYVRLRTRRQETMVATENEHTIILIQD 95
            |..:||||:..|.:|.....:.||::|:
  Fly    67 LVTIRLRTKVHEVIVLPSENYIIIVVQN 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 5..95 CDD:397386 24/89 (27%)
CG10834NP_610131.1 Robl_LC7 4..94 CDD:397386 24/89 (27%)

Return to query results.
Submit another query.