powered by:
Protein Alignment robl37BC and CG31275
DIOPT Version :9
Sequence 1: | NP_609931.1 |
Gene: | robl37BC / 35166 |
FlyBaseID: | FBgn0028569 |
Length: | 115 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_732175.1 |
Gene: | CG31275 / 326131 |
FlyBaseID: | FBgn0063261 |
Length: | 101 |
Species: | Drosophila melanogaster |
Alignment Length: | 44 |
Identity: | 17/44 - (38%) |
Similarity: | 30/44 - (68%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 LVILARSMVQDLENGDELSYVRLRTRRQETMVATENEHTIILIQ 94
||...:|:|:|::..::|.::||.||:.|.:||.|...||.::|
Fly 58 LVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVVQ 101
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
robl37BC | NP_609931.1 |
Robl_LC7 |
7..95 |
CDD:281277 |
17/44 (39%) |
CG31275 | NP_732175.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4115 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2020 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10779 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.950 |
|
Return to query results.
Submit another query.