DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and Dynlrb1

DIOPT Version :9

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_038960100.1 Gene:Dynlrb1 / 170714 RGDID:619910 Length:119 Species:Rattus norvegicus


Alignment Length:75 Identity:21/75 - (28%)
Similarity:50/75 - (66%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSYVRLRTRRQETMVATE 85
            ||.:...:|:|:::.:.......||:.|...::.|||.|::::..::|:::|:|:::.|.|||.:
  Rat    42 GAAVSVRDGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPD 106

  Fly    86 NEHTIILIQD 95
            .::.:|:||:
  Rat   107 KDYFLIVIQN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 20/73 (27%)
Dynlrb1XP_038960100.1 Robl_LC7 42..114 CDD:214939 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.