DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl37BC and dynlrb1

DIOPT Version :9

Sequence 1:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001093687.1 Gene:dynlrb1 / 100101695 XenbaseID:XB-GENE-489076 Length:96 Species:Xenopus tropicalis


Alignment Length:89 Identity:27/89 - (30%)
Similarity:56/89 - (62%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSY 70
            |:.|..|:....||.|.|:::..|:|:::.:.......||..|..||:.||..|:|::..::|::
 Frog     4 VEETLKRIQGQKGVQGIIIVNSEGIPIKSTMDNQTTVQYASLMHQLVMKARGSVRDIDCQNDLTF 68

  Fly    71 VRLRTRRQETMVATENEHTIILIQ 94
            :|:|:::.|.|:|.:.::.:|:||
 Frog    69 LRIRSKKNEIMIAPDKDYFLIVIQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 26/88 (30%)
dynlrb1NP_001093687.1 Robl_LC7 5..92 CDD:308728 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.