DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31792 and YKR104W

DIOPT Version :9

Sequence 1:NP_001260548.1 Gene:CG31792 / 35163 FlyBaseID:FBgn0051792 Length:1323 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:134/312 - (42%)
Similarity:193/312 - (61%) Gaps:29/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 MISVERMIEYEEIEPEGPLEATADKKPHESWPEQGKIEFVELSLRYEPYLKSESVLKSLSFVIKP 1085
            |.||||:.||.:|    |.|:.....|..:||:.|.:|...|||||.|:  |...|.::||.:|.
Yeast     1 MSSVERIKEYTDI----PSESNGYISPPANWPQTGDVELKNLSLRYSPH--SSKALDNVSFKVKA 59

  Fly  1086 KEKVGIVGRTGAGKSSLINALFRLS-YNDGSVRIDDKDTNDMGLHDLRSKISIIPQEPVLFSGTV 1149
            ..||||||||||||||:|.|::||| :.:|::.||:||...:.|..||:.||.|||:|.||.|||
Yeast    60 GTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTV 124

  Fly  1150 RHNLDPFDEYSDDRLWCALEEVELKDVVASVA-------------------TGLETKITEGGSNF 1195
            |.||||||.|||.:::..|.:|.|.:....:.                   ..|.|.:..||||.
Yeast   125 RSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNL 189

  Fly  1196 SVGQRQLVCLARAILRDNRILVMDEATANVDPQTDALIQATIRNKFRECTVLTVAHRLHTIMDSD 1260
            |.|||||:||||::|....|:::|||||::|..:||.||.|||...:..|:||:||||.:::|.|
Yeast   190 SQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYD 254

  Fly  1261 RVLVMDAGRVVEFGTPYELLTADDTNAFQDLVKQTGQATYDTLLKISQREFE 1312
            ::|||:.|||.|:..||.|: :|....|..|.:|:|:  ::.|.::::..|:
Yeast   255 KILVMEMGRVKEYDHPYTLI-SDRNTIFYRLCRQSGE--FENLFELAKVSFD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31792NP_001260548.1 CFTR_protein 12..1281 CDD:273530 127/279 (46%)
ABC_membrane 94..360 CDD:294371
ABCC_MRP_domain1 434..634 CDD:213217
ABC_membrane 736..980 CDD:294371
ABCC_MRP_domain2 1055..1276 CDD:213211 111/240 (46%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 113/244 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.