DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31792 and NAP5

DIOPT Version :9

Sequence 1:NP_001260548.1 Gene:CG31792 / 35163 FlyBaseID:FBgn0051792 Length:1323 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:328 Identity:103/328 - (31%)
Similarity:157/328 - (47%) Gaps:41/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 MDRRRYDLVVRKCALERDFELLPLKDKTILGDRGASLSGGQKARISLARSVYRDASIYLLDDPLS 587
            |||.|||.|:..|:|.:|.|:|...|:|::|:||.:||||||.||.:||::|:||.|||.|||.|
plant     1 MDRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFS 65

  Fly   588 AVDSSVARRLFEECLRGHLRDKIVILVTHQLQFLQQADQIVIMEMGKVKAVGTYESLHKSGLDF- 651
            |||:.....||:|.|||.|..|.||.||||::||..||..::|:.|::...|.|..:..||.|| 
plant    66 AVDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDILISGTDFR 130

  Fly   652 -------------GIVLDDPVNDNEAAEDRSRTSSITDQRRSSVKSVLSHAESCPEDVGEEQKIN 703
                         |......|::|.|.::.:  ..:.|......|......::...|.||.|:..
plant   131 ELIGAHQESLAVVGSADASSVSENSALDEEN--GVVRDDIGFDGKQESQDLKNDKLDSGEPQRQF 193

  Fly   704 LQRQQ--LGRNGLGVYVDYFR-AGGGFLSFSVVMTFFVCSQ---GLASLGDYFLSPWVSRNEKMV 762
            :|.::  .|...|.||..|.. |.||.|     :.|.:..|   .|..:|..:...|.       
plant   194 VQEEERAKGSVALDVYWKYITLAYGGAL-----VPFILLGQILFQLLQIGSNYWMAWA------- 246

  Fly   763 AHNYTTDAKDADFEMHAA---YIYMLITVLSIMVTIKRSFLFFNLAMRASIQLHNSMFRGISRAS 824
                |..::|....:..:   .:|:.:...|.:..:.|:.|......:.:.:|.:.|...|.|:.
plant   247 ----TPISEDVQAPVKLSTLMVVYVALAFGSSLCILVRATLLVTAGYKTATELFHKMHHCIFRSP 307

  Fly   825 MYF 827
            |.|
plant   308 MSF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31792NP_001260548.1 CFTR_protein 12..1281 CDD:273530 103/328 (31%)
ABC_membrane 94..360 CDD:294371
ABCC_MRP_domain1 434..634 CDD:213217 59/110 (54%)
ABC_membrane 736..980 CDD:294371 17/98 (17%)
ABCC_MRP_domain2 1055..1276 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 59/110 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2369
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.