DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10650 and CG4363

DIOPT Version :9

Sequence 1:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_611613.1 Gene:CG4363 / 37488 FlyBaseID:FBgn0034663 Length:199 Species:Drosophila melanogaster


Alignment Length:198 Identity:55/198 - (27%)
Similarity:75/198 - (37%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VGLFPANRR-QCYNCSGENCNAVSNTLVAGCSQIDAGCFTTGTSASNMTRGCTSATTEI------ 218
            ||...||.. .|:.|.|.||..|..:....|......|.|....|..:.:||   :.||      
  Fly    19 VGHVAANTAISCHTCEGANCQRVQLSKTQTCVDSLDYCVTIYDEAKVLFKGC---SLEIPKDLRS 80

  Fly   219 KCASDSTDPSCLVCNSDFCNSPTYEREAGSCIICE-----NCAEQQVATNAKSCGQAKYNQEVGC 278
            ||   :.:.||..||:..||:....:.|  ||.|:     |||....|..|..| .|.......|
  Fly    81 KC---NDNRSCHKCNTKECNNVGSAKYA--CIQCDSSKDSNCASNAAALEAARC-SAPTAPNSYC 139

  Fly   279 YTMTSGTNVTRGCLNTLEAGCSTTNACTSCSENGCNVAAGEFQCITCISNEVSGCWSAKYPDTLP 343
            |..:||.::.|        |||||........|..|       |:.|...::..|.:|...::..
  Fly   140 YVKSSGGSIVR--------GCSTTETDQQSCLNDAN-------CLLCSPGDIRNCNAANIVESSN 189

  Fly   344 LIN 346
            |.|
  Fly   190 LGN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 23/79 (29%)
DUF753 170..309 CDD:283175 43/149 (29%)
DUF753 277..370 CDD:283175 18/70 (26%)
CG4363NP_611613.1 DUF753 29..172 CDD:283175 46/166 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.