DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10650 and CG15347

DIOPT Version :9

Sequence 1:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001188562.1 Gene:CG15347 / 31779 FlyBaseID:FBgn0030040 Length:229 Species:Drosophila melanogaster


Alignment Length:183 Identity:50/183 - (27%)
Similarity:70/183 - (38%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CYSCTSTTNDTGNCLTSPSTQTSIEC---DNECYTLINAGTLTRGCLINGTACTLPSCST---CK 85
            |..|.|..|:  .|.|.|.:..:..|   .:.||:.:..|...|||.::....|..||:.   |:
  Fly    37 CIQCNSKDNE--RCATDPLSLLNRNCSDGSSNCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQ 99

  Fly    86 ----EDNCNLN------LVCQQCLG---EANCATTNVTDTQYNA-VCP--NNGQVCVNQLNDNKT 134
                .:.||.|      |:|.||.|   .::||    |:|..:| :||  ..|..|..: |.|:|
  Fly   100 LCTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCA----TETYVSAKICPLYKFGDKCYIR-NSNRT 159

  Fly   135 VTRQCGDPCAAGTESTCSSCSASLCNVGLFPANRRQ-------CYNCSGENCN 180
            |.......|                   |..||.|:       ||.|.|..||
  Fly   160 VDGSFQRGC-------------------LTSANARKQCVKDGNCYTCEGRGCN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 28/100 (28%)
DUF753 170..309 CDD:283175 6/18 (33%)
DUF753 277..370 CDD:283175
CG15347NP_001188562.1 DUF753 39..189 CDD:283175 46/175 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F712
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.