DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10650 and M02G9.3

DIOPT Version :9

Sequence 1:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_496221.1 Gene:M02G9.3 / 187406 WormBaseID:WBGene00010832 Length:294 Species:Caenorhabditis elegans


Alignment Length:265 Identity:69/265 - (26%)
Similarity:110/265 - (41%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCTSTTNDTGNCL-----------TSP--STQTSIECDNECYTL-INAGTLTRGC-LINGTACTL 78
            ||.|:::....|:           |:|  ..|.|.:|:.:|.:: |::|.....| ....:|||.
 Worm    41 SCCSSSSSNSYCIPVCMAQCQSSCTTPICQQQCSNQCNQQCTSITISSGPSCSSCQSACSSACTT 105

  Fly    79 PSC-STCKEDNC-NL-NLVCQQCLGEAN------CATTNVTDTQYNA---VCPNNGQ------VC 125
            |:| .||:.::| || |.....|....|      |.|.:.|:|..|:   .|.|.|.      :.
 Worm   106 PTCIRTCQRNSCSNLCNTGSNSCTNRCNSQCLQICTTPSCTNTCSNSCSNACSNGGNQPIVIVIP 170

  Fly   126 VNQLNDNKTVTRQCGDPCAAGTESTCSSCSASLCNVGLFPANRRQCYNCSGENCNAVSNTL--VA 188
            .:..|...:...||...|   |..||.....:.| :|       .|.:|||..||:.::.|  |.
 Worm   171 SSSRNCQNSCQNQCSSAC---TTMTCRQTCQNTC-LG-------SCNSCSGGGCNSNNSNLVVVT 224

  Fly   189 GCSQ-IDAGCFTTGTSASNMT-------RGC-----TSATTEIKCASDSTDPSC------LVCNS 234
            .|.: .::||.:|.:|.|.::       :.|     |:.|..|.|.|.::..||      .:|.|
 Worm   225 PCERSCNSGCRSTCSSTSTLSVCIPACQQTCRSTCSTAKTFVIPCTSGTSGNSCSCSTGYSICGS 289

  Fly   235 DFCNS 239
            ..|.|
 Worm   290 QCCRS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 42/175 (24%)
DUF753 170..309 CDD:283175 26/91 (29%)
DUF753 277..370 CDD:283175
M02G9.3NP_496221.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.