DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15170 and CG4363

DIOPT Version :9

Sequence 1:NP_609927.1 Gene:CG15170 / 35160 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_611613.1 Gene:CG4363 / 37488 FlyBaseID:FBgn0034663 Length:199 Species:Drosophila melanogaster


Alignment Length:195 Identity:46/195 - (23%)
Similarity:65/195 - (33%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LKCHHCAGQECVAAPASKPKPCRYHLEEDQCYTDVISSSDAYRGCTSEQNHTL------STSAQL 166
            :.||.|.|..|.....||.:.|...|  |.|.|....:...::||:.|....|      :.|...
  Fly    28 ISCHTCEGANCQRVQLSKTQTCVDSL--DYCVTIYDEAKVLFKGCSLEIPKDLRSKCNDNRSCHK 90

  Fly   167 CEINGCNEEQGAWTQVCATCDSAIGRGCKIDLFQVNTGRCNVSLYEECQQDVLLGEQEDKYCFSF 231
            |....|| ..|:....|..|||:....|..:...:...||:..            ...:.||:..
  Fly    91 CNTKECN-NVGSAKYACIQCDSSKDSNCASNAAALEAARCSAP------------TAPNSYCYVK 142

  Fly   232 RRLSRVVRGCSTKIPTDLEPYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCR-TNITAIAN 295
            .....:|||||| ..||.:                 .|:....|..|:..|...|. .||...:|
  Fly   143 SSGGSIVRGCST-TETDQQ-----------------SCLNDANCLLCSPGDIRNCNAANIVESSN 189

  Fly   296  295
              Fly   190  189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15170NP_609927.1 DUF753 35..166 CDD:283175 17/63 (27%)
DUF753 278..416 CDD:283175 6/19 (32%)
DUF753 351..506 CDD:283175
CG4363NP_611613.1 DUF753 29..172 CDD:283175 40/175 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.