DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15170 and CG10650

DIOPT Version :9

Sequence 1:NP_609927.1 Gene:CG15170 / 35160 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster


Alignment Length:437 Identity:98/437 - (22%)
Similarity:137/437 - (31%) Gaps:158/437 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSDRC-FGIVCYHCDSIALPECSQTLGEVGVLPYKECATE---------------LTCAMSIVDS 72
            :.|.| ..:||..|           |||.      .|||.               ..|...:.|:
  Fly    85 KEDNCNLNLVCQQC-----------LGEA------NCATTNVTDTQYNAVCPNNGQVCVNQLNDN 132

  Fly    73 ITY-RGCGAETPIIGATYS--KTCSTNLCNAGVYPPGRLKCHHCAGQECVAAPASKPKPCRYHLE 134
            .|. |.||  .|....|.|  .:||.:|||.|::|..|.:|::|:|:.|.|...:....|..  .
  Fly   133 KTVTRQCG--DPCAAGTESTCSSCSASLCNVGLFPANRRQCYNCSGENCNAVSNTLVAGCSQ--I 193

  Fly   135 EDQCYTDVISSSDAYRGCTSE------QNHTLSTSAQLCEINGCN-----EEQGAWTQVCATCDS 188
            :..|:|...|:|:..|||||.      .:.:...|..:|..:.||     .|.|:    |..|::
  Fly   194 DAGCFTTGTSASNMTRGCTSATTEIKCASDSTDPSCLVCNSDFCNSPTYEREAGS----CIICEN 254

  Fly   189 AIGRGCKIDLFQVNTGRCNVSLYEECQQDVLLGEQEDKYCFSFRRLSRVVRGCSTKIPTDLEPYV 253
                 |.......|...|..:.|           .::..|::....:.|.|||            
  Fly   255 -----CAEQQVATNAKSCGQAKY-----------NQEVGCYTMTSGTNVTRGC------------ 291

  Fly   254 EQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTCSSAEASSCFSCEYSNWSIQR 318
                 .||.:   |||.|...|.:|:   :..|..........||.|.|.|.|:|.:|       
  Fly   292 -----LNTLE---AGCSTTNACTSCS---ENGCNVAAGEFQCITCISNEVSGCWSAKY------- 338

  Fly   319 GCGAPPENPQITKCYECDEGAGCNSKDFTRCYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCV 383
                    |.......|..|.         ||      :|.    |...|               
  Fly   339 --------PDTLPLINCPNGT---------CY------SGV----WNELG--------------- 361

  Fly   384 VVSFNNATTARGC-----QKSDFSC-ASANVASCRLCEGSFCNKGSF 424
                     .|||     ....:.| |......|.||..|.|||..|
  Fly   362 ---------VRGCFTAASHLMQYQCNAKVEAHQCELCTESKCNKVPF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15170NP_609927.1 DUF753 35..166 CDD:283175 40/154 (26%)
DUF753 278..416 CDD:283175 26/143 (18%)
DUF753 351..506 CDD:283175 16/80 (20%)
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 43/160 (27%)
DUF753 170..309 CDD:283175 39/180 (22%)
DUF753 277..370 CDD:283175 33/173 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.