DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and MMGT1

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001316929.1 Gene:MMGT1 / 93380 HGNCID:28100 Length:131 Species:Homo sapiens


Alignment Length:101 Identity:56/101 - (55%)
Similarity:74/101 - (73%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIV 65
            |...|:..|:.|..|| |||||||||.||:|:||||:|..|||:||:|||:::..:..|.|:.|.
Human     1 MAPSLWKGLVGIGLFA-LAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIA 64

  Fly    66 GNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRAL 101
            |.||::.||.:::.||:|||.|.||||.||||||.|
Human    65 GEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 14/29 (48%)
MMGT1NP_001316929.1 MMgT 29..>61 CDD:402060 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8752
eggNOG 1 0.900 - - E1_KOG3918
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15570
Inparanoid 1 1.050 113 1.000 Inparanoid score I4855
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - oto90300
orthoMCL 1 0.900 - - OOG6_105066
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5472
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.