DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment EMC5 and AT5G03345

DIOPT Version :9

Sequence 1:	NP_609926.1	Gene:	EMC5 / 35159	FlyBaseID:	FBgn0032732	Length:	109	Species:	Drosophila melanogaster
Sequence 2:	NP_001318466.1	Gene:	AT5G03345 / 831867	AraportID:	AT5G03345	Length:	105	Species:	Arabidopsis thaliana

Alignment Length:	68	Identity:	19/68 - (27%)
Similarity:	37/68 - (54%)	Gaps:	0/68 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 LLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIVGNFKEIRA 73
            |:.:.|...|:|||:|.......|::.|:|::..|:::||:.:|.|.:.::..:...|.|..|..
plant     6 LVGVFGVLILSHAAYSTIQCIGLLKIMEEEFSRPPINVILELIIGLALCMWAALTFPGKFLSIHP 70

  Fly    74 TVD 76
            ..|
plant    71 DSD 73

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
EMC5	NP_609926.1	MMgT	<32..>62	CDD:402060	8/29 (28%)
AT5G03345	NP_001318466.1	None

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3918
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	54	1.000	Inparanoid score	I2610
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1558871at2759
OrthoFinder	1	1.000	-	-		FOG0004821
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	1	0.900	-	-		OOG6_105066
Panther	1	1.100	-	-	LDO	PTHR21181
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	9	8.830