DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and AT5G03345

DIOPT Version :10

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001318466.1 Gene:AT5G03345 / 831867 AraportID:AT5G03345 Length:105 Species:Arabidopsis thaliana


Alignment Length:68 Identity:19/68 - (27%)
Similarity:37/68 - (54%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIVGNFKEIRA 73
            |:.:.|...|:|||:|.......|::.|:|::..|:::||:.:|.|.:.::..:...|.|..|..
plant     6 LVGVFGVLILSHAAYSTIQCIGLLKIMEEEFSRPPINVILELIIGLALCMWAALTFPGKFLSIHP 70

  Fly    74 TVD 76
            ..|
plant    71 DSD 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:431186 8/29 (28%)
AT5G03345NP_001318466.1 None

Return to query results.
Submit another query.