DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and mmgt1

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001016553.1 Gene:mmgt1 / 549307 XenbaseID:XB-GENE-999449 Length:132 Species:Xenopus tropicalis


Alignment Length:109 Identity:57/109 - (52%)
Similarity:80/109 - (73%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIV 65
            |.|.::..|:.|..|| |||||||||.||:|:||||:|..:||:||:|||:::.::..|.|:.|.
 Frog     1 MASSIWKGLVGIGLFA-LAHAAFSAAQHRSYMRLTEKEDETLPIDIVLQTLLAFIVACYGIVHIA 64

  Fly    66 GNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRALNPGYTPPE 109
            |.||::.||.:::.||:|||.|.||||.||||||.:   :.|||
 Frog    65 GEFKDMDATSELRNKTFDTLRNHPSFYVFNHRGRVM---FQPPE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 13/29 (45%)
mmgt1NP_001016553.1 MMgT 27..>61 CDD:370939 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8859
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15570
Inparanoid 1 1.050 116 1.000 Inparanoid score I4668
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - oto104106
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5472
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.